Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8D1 Peptide - C-terminal region

OR8D1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JCG9, OR8D3, OST004, PDJ9J14

UniProt

Q8WZ84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8D1 Rabbit Polyclonal Antibody (orb587616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002917

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGXT2 Antibody, FITC conjugated
MBS7107573-01 0.05 mg

AGXT2 Antibody, FITC conjugated

Sign In for Pricing
View Details
AGXT2 Antibody, FITC conjugated
MBS7107573-02 0.1 mg

AGXT2 Antibody, FITC conjugated

Sign In for Pricing
View Details
AGXT2 Antibody, FITC conjugated
MBS7107573-03 5x 0.1 mg

AGXT2 Antibody, FITC conjugated

Sign In for Pricing
View Details
TGF-beta/Smad Antibody
orb3169596-01 1 mg

TGF-beta/Smad Antibody

Sign In for Pricing
View Details
TGF-beta/Smad Antibody
orb3169596-02 5 mg

TGF-beta/Smad Antibody

Sign In for Pricing
View Details
TGF-beta/Smad Antibody
orb3169596-03 10 mg

TGF-beta/Smad Antibody

Sign In for Pricing
View Details