Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS45 Peptide - C-terminal region

PRSS45 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TESSP5

UniProt

Q7RTY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS45 Rabbit Polyclonal Antibody (orb327093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954652

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WILAGVLSWEKACVKAQNPGVYTRITKYTKWIKKQMSNGAFSGPCASACL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd40 (BC023133) Mouse Untagged Clone
MC218427 10 µg

Ankrd40 (BC023133) Mouse Untagged Clone

Sign In for Pricing
View Details
4-bromo-2-phenyl-dibenzofuran
JH920353 1 Each

4-bromo-2-phenyl-dibenzofuran

Sign In for Pricing
View Details
(S, R, S) -AHPC-PEG2-amine hydrochloride salt
BIPC1038-01 100 mg

(S, R, S) -AHPC-PEG2-amine hydrochloride salt

Sign In for Pricing
View Details
(S, R, S) -AHPC-PEG2-amine hydrochloride salt
BIPC1038-02 250 mg

(S, R, S) -AHPC-PEG2-amine hydrochloride salt

Sign In for Pricing
View Details
Rat Synaptotagmin-7 (SYT7) ELISA Kit
EK20627 48 Tests

Rat Synaptotagmin-7 (SYT7) ELISA Kit

Sign In for Pricing
View Details
MST3 (STK24) (NM_003576) Human Tagged Lenti ORF Clone
RC217776L4 10 µg

MST3 (STK24) (NM_003576) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details