Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS45 Peptide - C-terminal region

PRSS45 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TESSP5

UniProt

Q7RTY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS45 Rabbit Polyclonal Antibody (orb327093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954652

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WILAGVLSWEKACVKAQNPGVYTRITKYTKWIKKQMSNGAFSGPCASACL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHX37 (NM_032656) Human Untagged Clone
SC104313 10 µg

DHX37 (NM_032656) Human Untagged Clone

Sign In for Pricing
View Details
MUS81 CRISPR Activation Plasmid (m2)
sc-428017-ACT-2 20 µg

MUS81 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Human prostacycline, PGI2 ELISA Kit
CSB-E09591h-01 48 Tests

Human prostacycline, PGI2 ELISA Kit

Sign In for Pricing
View Details
Human prostacycline, PGI2 ELISA Kit
CSB-E09591h-02 96 Tests

Human prostacycline, PGI2 ELISA Kit

Sign In for Pricing
View Details
Human prostacycline, PGI2 ELISA Kit
CSB-E09591h-03 5x 96 Tests

Human prostacycline, PGI2 ELISA Kit

Sign In for Pricing
View Details
Human prostacycline, PGI2 ELISA Kit
CSB-E09591h-04 10x 96 Tests

Human prostacycline, PGI2 ELISA Kit

Sign In for Pricing
View Details