Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PUS7L Peptide - N-terminal region

PUS7L Peptide - N-terminal region

Product Specifications

UniProt

Q9H0K6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PUS7L Rabbit Polyclonal Antibody (orb587728) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112582

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRELP (NM_201348) Human Recombinant Protein
TP307609L 1 mg

PRELP (NM_201348) Human Recombinant Protein

Sign In for Pricing
View Details
PNCK Human Gene Knockout Kit (CRISPR)
KN221855 1 Kit

PNCK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pipette Tips BPIC-403
BPIC-403 1 Unit

Pipette Tips BPIC-403

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS638306 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
MAP3K6 Antibody
8C10227-AAT 50 µg

MAP3K6 Antibody

Sign In for Pricing
View Details
RHCE (NM_020485) Human Over-expression Lysate
LY402791 100 µg

RHCE (NM_020485) Human Over-expression Lysate

Sign In for Pricing
View Details