Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PUS7L Peptide - N-terminal region

PUS7L Peptide - N-terminal region

Product Specifications

UniProt

Q9H0K6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PUS7L Rabbit Polyclonal Antibody (orb587728) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112582

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A agarose gel
EA-IP-015 2 mL

Protein A agarose gel

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Virus,  10nm
GM-602-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Virus, 10nm

Sign In for Pricing
View Details
Zfp322a Mouse Gene Knockout Kit (CRISPR)
KN519786 1 Kit

Zfp322a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FCGRT Human Gene Knockout Kit (CRISPR)
KN400364 1 Kit

FCGRT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MPZL (MPZL1) Rabbit Polyclonal Antibody
TA370466 100 µL

MPZL (MPZL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS502754 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details