RAPGEFL1 Peptide - C-terminal region
RAPGEFL1 Peptide - C-terminal region
Product Specifications
UniProt
Q9UHV5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAPGEFL1 Rabbit Polyclonal Antibody (orb587732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFKNLFRKFENLTDPCRNHKSYREVISKMKPPVIPFVPLILKDLTFLHEG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TWEAKR Recombinant Rabbit Monoclonal Antibody [SN20-07]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82c94/imageurl/et1611-93.webp)
ET1611-93 100 µL
TWEAKR Recombinant Rabbit Monoclonal Antibody [SN20-07]
Sign In for Pricing
View Details 
AP02242SU-S 20 µL
Tuberoinfundibular peptide (PTH2) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
TRC-B280591-50MG 50 mg
1,4-Bis(2-hydroxyethyl) 2,5-dihydroxy-1,4-benzenedicarboxylate-d8
Sign In for Pricing
View Details 
