RAPGEFL1 Peptide - C-terminal region
RAPGEFL1 Peptide - C-terminal region
Product Specifications
UniProt
Q9UHV5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAPGEFL1 Rabbit Polyclonal Antibody (orb587732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFKNLFRKFENLTDPCRNHKSYREVISKMKPPVIPFVPLILKDLTFLHEG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH030348 50 µg
Recombinant Human c-Yes/YES1 Protein (His & GST Tag)
Sign In for Pricing
View Details 
![Topoisomerase II alpha (TOP2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D4]](https://cdn.genprice.uk/products/937/6868c3a0994c49e6dc3fb7f8/imageurl/ta802383bm.webp)
TA802383BM 100 µL
Topoisomerase II alpha (TOP2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D4]
Sign In for Pricing
View Details 
BNC682669-500 1x 500 µL
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2669), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP05510PU-N 1 mL
Prostate Specific Antigen (KLK3) Sheep Polyclonal Antibody
Sign In for Pricing
View Details