RNF19B Peptide - C-terminal region
RNF19B Peptide - C-terminal region
Product Specifications
UniProt
Q6ZMZ0
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNF19B Rabbit Polyclonal Antibody (orb587739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VHAQMAENEEEGSGGGGSEEDPPCRHQSCEQKDCLASKPWDISLAQPESI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-P688530-50MG 50 mg
Polyethylene Terephthalate, (contains 30% glass particles as reinforcer)
Sign In for Pricing
View Details 
BNUB3046-500 1x 500 µL
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), 0.2mg/mL
Sign In for Pricing
View Details 
HP218191 200 Reactions
Meckelin (TMEM67) Human qPCR Primer Pair (NM_153704)
Sign In for Pricing
View Details