RNF19B Peptide - C-terminal region
RNF19B Peptide - C-terminal region
Product Specifications
UniProt
Q6ZMZ0
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNF19B Rabbit Polyclonal Antibody (orb587739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VHAQMAENEEEGSGGGGSEEDPPCRHQSCEQKDCLASKPWDISLAQPESI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY431680 100 µg
Neurofascin (NFASC) (NM_001160331) Human Over-expression Lysate
Sign In for Pricing
View Details 
AP21238AF-N 10 mg
Butyrylcholinesterase (BCHE) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC401610-500 1x 500 µL
CD51 / Integrin V (ITGAV/1610), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details