Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERGEF Peptide - C-terminal region

SERGEF Peptide - C-terminal region

Product Specifications

Product Name Alternative

DELGEF, Gnefr

UniProt

Q9UGK8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERGEF Rabbit Polyclonal Antibody (orb587745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036271

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HPALVQDPKVTYLSPDAIEDTESQKAMDKERNWKERQSETSTQSQSDWSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Di-tert-butyl-6-(5-chloro-2H-benzotriazol-2-yl)phenol-d20
TRC-D428017-2.5MG 2.5 mg

2,4-Di-tert-butyl-6-(5-chloro-2H-benzotriazol-2-yl)phenol-d20

Sign In for Pricing
View Details
HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF640R conjugate, 0.1mg/mL
BNC401574-100 1x 100 µL

HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCV TaqMan Probe/Primer and Control Set
TM37610 100 Reactions

HCV TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
VRL1 (TRPV2) (NM_016113) Human Over-expression Lysate
LC402501 20 µg

VRL1 (TRPV2) (NM_016113) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), 1mg/mL
BNUM1840-50 1x 50 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), 1mg/mL

Sign In for Pricing
View Details
Kdelr2 (NM_025841) Mouse Tagged ORF Clone
MG202320 10 µg

Kdelr2 (NM_025841) Mouse Tagged ORF Clone

Sign In for Pricing
View Details