Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERGEF Peptide - C-terminal region

SERGEF Peptide - C-terminal region

Product Specifications

Product Name Alternative

DELGEF, Gnefr

UniProt

Q9UGK8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERGEF Rabbit Polyclonal Antibody (orb587745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036271

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HPALVQDPKVTYLSPDAIEDTESQKAMDKERNWKERQSETSTQSQSDWSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD300 antigen (CD300A) Mouse Monoclonal Antibody [Clone ID: MEM-260]
AM03062RP-N 100 Tests

CD300 antigen (CD300A) Mouse Monoclonal Antibody [Clone ID: MEM-260]

Sign In for Pricing
View Details
DUSP23 (NM_017823) Human Over-expression Lysate
LY402621 100 µg

DUSP23 (NM_017823) Human Over-expression Lysate

Sign In for Pricing
View Details
EDAR Antibody
KC-7891-01 50 μL

EDAR Antibody

Sign In for Pricing
View Details
EDAR Antibody
KC-7891-02 100 µL

EDAR Antibody

Sign In for Pricing
View Details
EDAR Antibody
KC-7891-03 1 mL

EDAR Antibody

Sign In for Pricing
View Details
Mouse Emx1 activation kit by CRISPRa
GA201236 1 Kit

Mouse Emx1 activation kit by CRISPRa

Sign In for Pricing
View Details