Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIOX2 Peptide - C-terminal region

RIOX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ROX, MDIG, MINA, NO52, JMJD10, MINA53

UniProt

Q8IUF8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIOX2 Rabbit Polyclonal Antibody (orb573553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694822

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thromboxane synthase Rabbit pAb
E45R29964N-50 50 µL

Thromboxane synthase Rabbit pAb

Sign In for Pricing
View Details
ST3GAL6 (NM_001271146) Human Tagged ORF Clone
RC232500 10 µg

ST3GAL6 (NM_001271146) Human Tagged ORF Clone

Sign In for Pricing
View Details
Dengue Envelope - 1 & 3 (Recombinant)
22060048-1 100 µg

Dengue Envelope - 1 & 3 (Recombinant)

Sign In for Pricing
View Details
CTNNBL1, NT (CTNNBL1, C20orf33, Beta-catenin-like protein 1, Nuclear-associated protein, Testis development protein NYD-SP19) (FITC) discontinued
034338-FITC 200 µL

CTNNBL1, NT (CTNNBL1, C20orf33, Beta-catenin-like protein 1, Nuclear-associated protein, Testis development protein NYD-SP19) (FITC) discontinued

Sign In for Pricing
View Details
Anti-Human VMAT2 Recombinant Antibody (JP1217)
HC560043-01 50 µg

Anti-Human VMAT2 Recombinant Antibody (JP1217)

Sign In for Pricing
View Details
Anti-Human VMAT2 Recombinant Antibody (JP1217)
HC560043-02 100 µg

Anti-Human VMAT2 Recombinant Antibody (JP1217)

Sign In for Pricing
View Details