Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIOX2 Peptide - C-terminal region

RIOX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ROX, MDIG, MINA, NO52, JMJD10, MINA53

UniProt

Q8IUF8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIOX2 Rabbit Polyclonal Antibody (orb573553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694822

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cry2 (NM_133405) Rat Tagged ORF Clone Lentiviral Particle
RR210144L3V 200 µL

Cry2 (NM_133405) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LY 243670
orb1696280 25 mg

LY 243670

Sign In for Pricing
View Details
Lentiviral mouse Man1a shRNA (UAS) - Lentiviral mouseMan1a shRNA (UAS, GFP) (25)
GTR15187796 1 Vial

Lentiviral mouse Man1a shRNA (UAS) - Lentiviral mouseMan1a shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rat Carbohydrate Sulfotransferase 3 (CHST3) ELISA Kit
abx506672 96 Tests

Rat Carbohydrate Sulfotransferase 3 (CHST3) ELISA Kit

Sign In for Pricing
View Details
S100A6 Recombinant Rabbit mAb, HRP conjugated
orb3163363 100 µL

S100A6 Recombinant Rabbit mAb, HRP conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal NKX2.8 Antibody (NKX28/3233R) [DyLight 594]
NBP3-08653DL594 100 µL

Rabbit Monoclonal NKX2.8 Antibody (NKX28/3233R) [DyLight 594]

Sign In for Pricing
View Details