Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXR1 Peptide - N-terminal region

FOXR1 Peptide - N-terminal region

Product Specifications

UniProt

Q08AS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXR1 Rabbit Polyclonal Antibody (orb573944) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLAFTTSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BTN3A1 sgRNA gene knockout kit - Lentiviral human BTN3A1 sgRNA gene knockout kit (plasmid)
GTR15396161 1 Vial

Lentiviral human BTN3A1 sgRNA gene knockout kit - Lentiviral human BTN3A1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Guaifenesin
BUP19171 1 g

Guaifenesin

Sign In for Pricing
View Details
Gbp11 (NM_001039647) Mouse Tagged ORF Clone
MR209483 10 µg

Gbp11 (NM_001039647) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KHDRBS3 antibody
70R-4610 100 µL

KHDRBS3 antibody

Sign In for Pricing
View Details
DDR2, Recombinant, Human (Discoidin Domain Receptor 2)
MBS637031-01 0.05 mg

DDR2, Recombinant, Human (Discoidin Domain Receptor 2)

Sign In for Pricing
View Details
DDR2, Recombinant, Human (Discoidin Domain Receptor 2)
MBS637031-02 5x 0.05 mg

DDR2, Recombinant, Human (Discoidin Domain Receptor 2)

Sign In for Pricing
View Details