Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXR1 Peptide - N-terminal region

FOXR1 Peptide - N-terminal region

Product Specifications

UniProt

Q08AS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXR1 Rabbit Polyclonal Antibody (orb573944) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLAFTTSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR1C Protein Vector (Human) (pPB-C-His)
PV000605 500 ng

ACVR1C Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
KAT2A ORF Vector (Human) (pORF)
ORF005511 1.0 µg DNA

KAT2A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PABPC5 (NM_080832) Human Recombinant Protein
TP760461 50 µg

PABPC5 (NM_080832) Human Recombinant Protein

Sign In for Pricing
View Details
PCDHA7 Human shRNA Lentiviral Particle (Locus ID 56141)
TL311713V 500 µL Each

PCDHA7 Human shRNA Lentiviral Particle (Locus ID 56141)

Sign In for Pricing
View Details
ESA4 sgRNA CRISPR Lentivector set (Human)
K0695801 3x 1.0 µg

ESA4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
JAK3 Protein Vector (Mouse) (pPM-C-HA)
PV192876 500 ng

JAK3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details