Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFX4 Peptide - N-terminal region

RFX4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NYD-SP10

UniProt

Q33E94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RFX4 Rabbit Polyclonal Antibody (orb574564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998759

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAChT / SLC18A3 Recombinant Rabbit monoclonal Antibody
HA751353 100 µL

VAChT / SLC18A3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD24 Antibody
RD21969F-01 25 µg

APC Anti-Mouse CD24 Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD24 Antibody
RD21969F-02 100 µg

APC Anti-Mouse CD24 Antibody

Sign In for Pricing
View Details
1,2-Diphenylethanol
TRC-D491598-50MG 50 mg

1,2-Diphenylethanol

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G4]
TA505659BM 100 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G4]

Sign In for Pricing
View Details
Biguanide Hydrochloride
TRC-B016556-5G 5 g

Biguanide Hydrochloride

Sign In for Pricing
View Details