Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFX4 Peptide - N-terminal region

RFX4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NYD-SP10

UniProt

Q33E94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RFX4 Rabbit Polyclonal Antibody (orb574564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998759

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hydroxyphenone
TRC-H829320-5G 5 g

2-Hydroxyphenone

Sign In for Pricing
View Details
Acyclovir Formacetal Dimer (>90%)
TRC-A192435-25MG 25 mg

Acyclovir Formacetal Dimer (>90%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503699 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Ethyl 7-Aminothieno[2,3-b]pyrazine-6-carboxylate
TRC-E899665-250MG 250 mg

Ethyl 7-Aminothieno[2,3-b]pyrazine-6-carboxylate

Sign In for Pricing
View Details
Mouse Adsl activation kit by CRISPRa
GA200107 1 Kit

Mouse Adsl activation kit by CRISPRa

Sign In for Pricing
View Details
Human LRRC25 activation kit by CRISPRa
GA114939 1 Kit

Human LRRC25 activation kit by CRISPRa

Sign In for Pricing
View Details