Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JADE1 Peptide - C-terminal region

JADE1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHF17

UniProt

Q6IE81

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JADE1 Rabbit Polyclonal Antibody (orb324576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001274366.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLAEALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf85 Rabbit pAb
E47R15345 100 µL

C9orf85 Rabbit pAb

Sign In for Pricing
View Details
HnRNP A1 Recombinant Antibody, RBITC Conjugated
bsm-61490R-RBITC-01 20 µL

HnRNP A1 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
HnRNP A1 Recombinant Antibody, RBITC Conjugated
bsm-61490R-RBITC-02 100 µL

HnRNP A1 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Hbe1 3'UTR GFP Stable Cell Line
TU255656 1.0 mL

Hbe1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Brivaracetam Impurity 64
RM-B180990-01 10 mg

Brivaracetam Impurity 64

Sign In for Pricing
View Details
Brivaracetam Impurity 64
RM-B180990-02 25 mg

Brivaracetam Impurity 64

Sign In for Pricing
View Details