Esr2 Peptide - N-terminal region
Esr2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ER[b], ERbeta, Estrb
UniProt
O08537
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Esr2 Rabbit Polyclonal Antibody (orb576189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997590
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SQSILPLEHGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PC109625 1 g
4- (4-Chloro-2-trifluoromethyl-phenyl) -pyridine-2-carbonitrile
Sign In for Pricing
View Details MBS144098-01 0.005 mg
Recombinant Human Geranylgeranyl Diphosphate Synthase 1
Sign In for Pricing
View Details MBS144098-02 0.02 mg
Recombinant Human Geranylgeranyl Diphosphate Synthase 1
Sign In for Pricing
View Details