Esr2 Peptide - N-terminal region
Esr2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ER[b], ERbeta, Estrb
UniProt
O08537
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Esr2 Rabbit Polyclonal Antibody (orb576189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997590
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SQSILPLEHGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2577919 100 µg
Integrin beta 3/ITGB3 Rabbit Polyclonal Antibody (APC)
Sign In for Pricing
View Details C2392-30Z-01 100 µg
CD40 Ligand, soluble, Recombinant, Human, aa113-261, His-Tag (CD40 Ligand, CD40-L, CD40L, CD40LG, hCD40L, sCD40L, CD178, gp39, HIGM1, IGM, IMD3, T-BAM, T-cell Antigen GP39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, TNF Ligand Superfamily Member 5, TNFSF5)
Sign In for Pricing
View Details C2392-30Z-02 500 µg
CD40 Ligand, soluble, Recombinant, Human, aa113-261, His-Tag (CD40 Ligand, CD40-L, CD40L, CD40LG, hCD40L, sCD40L, CD178, gp39, HIGM1, IGM, IMD3, T-BAM, T-cell Antigen GP39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, TNF Ligand Superfamily Member 5, TNFSF5)
Sign In for Pricing
View Details