Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mkx Peptide - C-terminal region

Mkx Peptide - C-terminal region

Product Specifications

Product Name Alternative

9430023B20Rik, Irxl1

UniProt

Q8BIA3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mkx Rabbit Polyclonal Antibody (orb576342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808263

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP-8 Recombinant Rabbit Monoclonal Antibody [JE59-38]
HA721686 100 µL

MMP-8 Recombinant Rabbit Monoclonal Antibody [JE59-38]

Sign In for Pricing
View Details
Tmem67 Mouse Gene Knockout Kit (CRISPR)
KN517892 1 Kit

Tmem67 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Factor (F3) Rabbit Monoclonal Antibody [Clone ID: R01-8E5]
TA421615 100 µL

Tissue Factor (F3) Rabbit Monoclonal Antibody [Clone ID: R01-8E5]

Sign In for Pricing
View Details
JMY (NM_152405) Human Over-expression Lysate
LC432410 20 µg

JMY (NM_152405) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant ALKBH4 Antibody
RC-4207-01 50 μL

Recombinant ALKBH4 Antibody

Sign In for Pricing
View Details
Recombinant ALKBH4 Antibody
RC-4207-02 100 µL

Recombinant ALKBH4 Antibody

Sign In for Pricing
View Details