Mkx Peptide - C-terminal region
Mkx Peptide - C-terminal region
Product Specifications
Product Name Alternative
9430023B20Rik, Irxl1
UniProt
Q8BIA3
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mkx Rabbit Polyclonal Antibody (orb576342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_808263
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY400043 100 µg
Factor XI (F11) (NM_000128) Human Over-expression Lysate
Sign In for Pricing
View Details 
