Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF202 Peptide - N-terminal region

ZNF202 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZSCAN42, ZKSCAN10

UniProt

O95125

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF202 Rabbit Polyclonal Antibody (orb324758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001288708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Choline kinase alpha (CHKA) (NM_212469) Human Over-expression Lysate
LC403943 20 µg

Choline kinase alpha (CHKA) (NM_212469) Human Over-expression Lysate

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF594 conjugate, 0.1mg/mL
BNC941812-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human METTL1 Protein (His Tag)
PKSH031101 100 µg

Recombinant Human METTL1 Protein (His Tag)

Sign In for Pricing
View Details
Platinum (IV) Oxide
TRC-P578000-1G 1 g

Platinum (IV) Oxide

Sign In for Pricing
View Details
1-[(2R)-N’-Boc-2-amino-2-cyclohexylacetyl]-N-(4’-cyanobenzyl)-2-L-azetidinecarboxamide
TRC-B617670-5MG 5 mg

1-[(2R)-N’-Boc-2-amino-2-cyclohexylacetyl]-N-(4’-cyanobenzyl)-2-L-azetidinecarboxamide

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF405S conjugate, 0.1mg/mL
BNC041274-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details