Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED6 Peptide - N-terminal region

MED6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NY-REN-28

UniProt

O75586

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED6 Rabbit Polyclonal Antibody (orb576767) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005457

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pebp4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4625606 1.0 µg DNA

Pebp4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Chicken Cell adhesion molecule 3 (CADM3) ELISA kit
GTR10380491 96 Well

Chicken Cell adhesion molecule 3 (CADM3) ELISA kit

Sign In for Pricing
View Details
Active Clara Cell Protein 16 (CC16)
SBPA197Mu01-01 10 µg

Active Clara Cell Protein 16 (CC16)

Sign In for Pricing
View Details
Active Clara Cell Protein 16 (CC16)
SBPA197Mu01-02 50 µg

Active Clara Cell Protein 16 (CC16)

Sign In for Pricing
View Details
Active Clara Cell Protein 16 (CC16)
SBPA197Mu01-03 200 µg

Active Clara Cell Protein 16 (CC16)

Sign In for Pricing
View Details
Active Clara Cell Protein 16 (CC16)
SBPA197Mu01-04 1 mg

Active Clara Cell Protein 16 (CC16)

Sign In for Pricing
View Details