Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED6 Peptide - N-terminal region

MED6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NY-REN-28

UniProt

O75586

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED6 Rabbit Polyclonal Antibody (orb576767) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005457

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA2 Antibody, Biotin conjugated
A25445-100UG 100 µg

ANXA2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Thymidylate Synthase Antibody Cocktail
V3164SAF-100UG 100 µg

Thymidylate Synthase Antibody Cocktail

Sign In for Pricing
View Details
Interferon regulatory factor 1
orb1640531-01 50 µg

Interferon regulatory factor 1

Sign In for Pricing
View Details
Interferon regulatory factor 1
orb1640531-02 100 µg

Interferon regulatory factor 1

Sign In for Pricing
View Details
Interferon regulatory factor 1
orb1640531-03 1 mg

Interferon regulatory factor 1

Sign In for Pricing
View Details
Recombinant SPTA1 Antibody / Spectrin alpha 1
V7423-20UG 20 µg

Recombinant SPTA1 Antibody / Spectrin alpha 1

Sign In for Pricing
View Details