Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED6 Peptide - C-terminal region

MED6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NY-REN-28

UniProt

O75586

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED6 Rabbit Polyclonal Antibody (orb576768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_005457

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromopentyl Acetate
TRC-B686100-25G 25 g

5-Bromopentyl Acetate

Sign In for Pricing
View Details
ZNF780A Human Gene Knockout Kit (CRISPR)
KN423976 1 Kit

ZNF780A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Acvr1b activation kit by CRISPRa
GA200053 1 Kit

Mouse Acvr1b activation kit by CRISPRa

Sign In for Pricing
View Details
CENPL (NM_001171182) Human Over-expression Lysate
LC432913 20 µg

CENPL (NM_001171182) Human Over-expression Lysate

Sign In for Pricing
View Details
UBE2E3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B7]
TA800057BM 100 µL

UBE2E3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B7]

Sign In for Pricing
View Details
STAU1 Antibody
KC-2034-01 50 μL

STAU1 Antibody

Sign In for Pricing
View Details