Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED6 Peptide - C-terminal region

MED6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NY-REN-28

UniProt

O75586

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED6 Rabbit Polyclonal Antibody (orb576768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_005457

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3ORF31 (TAMM41) Rabbit Polyclonal Antibody
TA382295 100 µL

C3ORF31 (TAMM41) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD19 Antibody[4G7]
E-AB-F11270-01 100 µg

AF/LE Purified Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD19 Antibody[4G7]
E-AB-F11270-02 1 mg

AF/LE Purified Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD19 Antibody[4G7]
E-AB-F11270-03 5 mg

AF/LE Purified Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD19 Antibody[4G7]
E-AB-F11270-04 25 mg

AF/LE Purified Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD19 Antibody[4G7]
E-AB-F11270-05 50 mg

AF/LE Purified Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details