DESI2 Peptide - C-terminal region
DESI2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C1orf121, DESI, DESI1, DeSI-2, FAM152A, PNAS-4, PPPDE1
UniProt
Q9BSY9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DESI2 Rabbit Polyclonal Antibody (orb324957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057160
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MAP3K4 Rabbit Monoclonal Antibody [Clone ID: R05-8A5]](https://cdn.genprice.uk/products/937/68dd1b61061270361ea12567/imageurl/ta422180.webp)
TA422180 100 µL
MAP3K4 Rabbit Monoclonal Antibody [Clone ID: R05-8A5]
Sign In for Pricing
View Details 
