Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCH2 Peptide - C-terminal region

MARCH2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MARCH-II, RNF172

UniProt

Q9P0N8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MARCH2 Rabbit Polyclonal Antibody (orb55671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057580

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gli2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4426702 1.0 µg DNA

Gli2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Connexin 31 Antibody (C-term) Blocking peptide
MBS9221339-01 0.5 mg

Connexin 31 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Connexin 31 Antibody (C-term) Blocking peptide
MBS9221339-02 5x 0.5 mg

Connexin 31 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Sheep Crimean-Congo Hemorrhagic Fever Virus (CCHFV) ELISA Kit
SL00172Sp-01 48 Tests

Sheep Crimean-Congo Hemorrhagic Fever Virus (CCHFV) ELISA Kit

Sign In for Pricing
View Details
Sheep Crimean-Congo Hemorrhagic Fever Virus (CCHFV) ELISA Kit
SL00172Sp-02 96 Tests

Sheep Crimean-Congo Hemorrhagic Fever Virus (CCHFV) ELISA Kit

Sign In for Pricing
View Details
T-cell surface glycoprotein CD3 epsilon chain
orb1642931-01 50 µg

T-cell surface glycoprotein CD3 epsilon chain

Sign In for Pricing
View Details