Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCH2 Peptide - C-terminal region

MARCH2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MARCH-II, RNF172

UniProt

Q9P0N8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MARCH2 Rabbit Polyclonal Antibody (orb55671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057580

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LKB1/STK11 Antibody (OTI0A3) [DyLight 650]
NBP2-71300C 0.1 mL

Mouse Monoclonal LKB1/STK11 Antibody (OTI0A3) [DyLight 650]

Sign In for Pricing
View Details
PARS2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1596904 1.0 µg DNA

PARS2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PAO CRISPR Activation Plasmid (h)
sc-404683-ACT 20 µg

PAO CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
E1 (NC_014952) Virus Tagged ORF Clone
VC101857 10 µg

E1 (NC_014952) Virus Tagged ORF Clone

Sign In for Pricing
View Details
Prokaryotic Human Proteasome 26S Subunit, Non ATPase 8
RPU61825-01 50 µg

Prokaryotic Human Proteasome 26S Subunit, Non ATPase 8

Sign In for Pricing
View Details
Prokaryotic Human Proteasome 26S Subunit, Non ATPase 8
RPU61825-02 100 µg

Prokaryotic Human Proteasome 26S Subunit, Non ATPase 8

Sign In for Pricing
View Details