Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HACE1 Peptide - N-terminal region

HACE1 Peptide - N-terminal region

Product Specifications

UniProt

Q8IYU2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HACE1 Rabbit Polyclonal Antibody (orb578776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065822

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cartilage oligomeric protein (COMP) Human ELISA Kit
C1514 96 Tests

Cartilage oligomeric protein (COMP) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human CD22 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUCD22AP843200UL 200 µL

Rabbit Anti Human CD22 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
RSK3 protein
30R-2883 5 ug

RSK3 protein

Sign In for Pricing
View Details
Glypican 1 Antibody FITC Conjugated
MBS9461023-01 0.1 mL

Glypican 1 Antibody FITC Conjugated

Sign In for Pricing
View Details
Glypican 1 Antibody FITC Conjugated
MBS9461023-02 5x 0.1 mL

Glypican 1 Antibody FITC Conjugated

Sign In for Pricing
View Details
SYCE2 (NM_001105578) Human Over-expression Lysate
E45H02601-2 20 µg

SYCE2 (NM_001105578) Human Over-expression Lysate

Sign In for Pricing
View Details