Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNTL6 Peptide - N-terminal region

GALNTL6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GALNT17

UniProt

Q49A17

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNTL6 Rabbit Polyclonal Antibody (orb579300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001030017

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTSL5 Recombinant Protein Antigen
NBP1-93438PEP 0.1 mL

ADAMTSL5 Recombinant Protein Antigen

Sign In for Pricing
View Details
Tenascin Antibody (YA7312, Rabbit)
HY-P87628 1 Each

Tenascin Antibody (YA7312, Rabbit)

Sign In for Pricing
View Details
OsMADS62 Antibody
MBS858576-01 0.1 mg

OsMADS62 Antibody

Sign In for Pricing
View Details
OsMADS62 Antibody
MBS858576-02 0.1 mL (AF405L)

OsMADS62 Antibody

Sign In for Pricing
View Details
OsMADS62 Antibody
MBS858576-03 0.1 mL (AF405S)

OsMADS62 Antibody

Sign In for Pricing
View Details
OsMADS62 Antibody
MBS858576-04 0.1 mL (AF610)

OsMADS62 Antibody

Sign In for Pricing
View Details