Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNTL6 Peptide - N-terminal region

GALNTL6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GALNT17

UniProt

Q49A17

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNTL6 Rabbit Polyclonal Antibody (orb579300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001030017

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LC3A Mouse Monoclonal Antibody (PE-Cy5)
orb958929 100 µL

LC3A Mouse Monoclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
PUS7 Protein Vector (Mouse) (pPM-C-HA)
PV221224 500 ng

PUS7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CREB5 antibody
FNab01966 100 µg

CREB5 antibody

Sign In for Pricing
View Details
Ppp6c (NM_024209) Mouse Tagged ORF Clone Lentiviral Particle
MR204292L4V 200 µL

Ppp6c (NM_024209) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
STF-991- 210X297-B7527 AC Signs
912526 Card of 1 Pictogram(s)

STF-991- 210X297-B7527 AC Signs

Sign In for Pricing
View Details
Gcnt3 (BC018297) Mouse Tagged ORF Clone
MG206243 10 µg

Gcnt3 (BC018297) Mouse Tagged ORF Clone

Sign In for Pricing
View Details