TMPPE Peptide - N-terminal region
TMPPE Peptide - N-terminal region
Product Specifications
UniProt
Q6ZT21
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMPPE Rabbit Polyclonal Antibody (orb579330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001129710
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVGRTKMEMFVRMVNVLEPDITVIVGDLSDSEASVLRTAVAPLGQLHSHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-B395826-10MG 10 mg
N-Biotinyl-N’-cysteinyl Ethylenediamine Trifluoroacetic Acid Salt
Sign In for Pricing
View Details ![MASP2 Mouse Monoclonal Antibody [Clone ID: OTI7C4]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908d84/imageurl/cf812531.webp)
LC434154 20 µg
Nck (NCK1) (NM_001190796) Human Over-expression Lysate
Sign In for Pricing
View Details 