Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPPE Peptide - N-terminal region

TMPPE Peptide - N-terminal region

Product Specifications

UniProt

Q6ZT21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPPE Rabbit Polyclonal Antibody (orb579330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129710

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVGRTKMEMFVRMVNVLEPDITVIVGDLSDSEASVLRTAVAPLGQLHSHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S1P (MBTPS1) activation kit by CRISPRa
GA105786 1 Kit

Human S1P (MBTPS1) activation kit by CRISPRa

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880385-100 1x 100 µL

CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB600654 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: 1E7]
AM26639AF-N 100 µg

Sumo 2 (SUMO2) Mouse Monoclonal Antibody [Clone ID: 1E7]

Sign In for Pricing
View Details
Bromothymol Blue
TRC-B699310-5G 5 g

Bromothymol Blue

Sign In for Pricing
View Details
ANKIB1 Antibody
KC-30404-01 50 μL

ANKIB1 Antibody

Sign In for Pricing
View Details