Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKTN Peptide - N-terminal region

FKTN Peptide - N-terminal region

Product Specifications

Product Name Alternative

CMD1X, FCMD, LGMD2M, MDDGA4, MDDGB4, MDDGC4

UniProt

O75072

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FKTN Rabbit Polyclonal Antibody (orb579370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006722

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLTLTSSAFLLFQLYYYKHYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-100 1x 100 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-500 1x 500 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF488A conjugate, 0.1mg/mL
BNC881060-100 1x 100 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), CF568 conjugate, 0.1mg/mL
BNC680732-500 1x 500 µL

TAG-72 / CA72.4 (CC49), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (Bra7G), 1mg/mL
BNUM0302-50 1x 50 µL

CD43 (Bra7G), 1mg/mL

Sign In for Pricing
View Details