FKTN Peptide - C-terminal region
FKTN Peptide - C-terminal region
Product Specifications
UniProt
I6L9J5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FKTN Rabbit Polyclonal Antibody (orb579372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FGKVEDSLELSFQGKDDVKLDVFFFYEETDHMWNGGTQAKTGKKFKYLFP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880029-100 1x 100 µL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472759-100 1x 100 µL
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881969-100 1x 100 µL
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 