Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART3 Peptide - N-terminal region

ART3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARTC3

UniProt

Q13508

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ART3 Rabbit Polyclonal Antibody (orb579380) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001170

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHFYLTRALQLLRKPCEASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF2 Antibody
CSB-PA011237-01 50 µg

IRF2 Antibody

Sign In for Pricing
View Details
IRF2 Antibody
CSB-PA011237-02 100 µg

IRF2 Antibody

Sign In for Pricing
View Details
Rims2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6958502 1.0 µg DNA

Rims2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Cycloheximide for biochemistry
1101KG001 1 Kg

Cycloheximide for biochemistry

Sign In for Pricing
View Details
Stra8 Rabbit Polyclonal Antibody (Biotin)
orb2578441 100 µg

Stra8 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CCR1 Rabbit Polyclonal Antibody (APC)
orb2570233 100 µg

CCR1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details