Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART3 Peptide - N-terminal region

ART3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARTC3

UniProt

Q13508

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ART3 Rabbit Polyclonal Antibody (orb579380) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001170

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHFYLTRALQLLRKPCEASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Akt (Thr450) Rabbit Polyclonal Antibody (PerCP)
orb1604020 100 µL

Phospho-Akt (Thr450) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Trifluorovinyl chlorosulphate
sc-264471 25 g

Trifluorovinyl chlorosulphate

Sign In for Pricing
View Details
Adam25 3'UTR Luciferase Stable Cell Line
TU101366 1.0 mL

Adam25 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Gatb (NM_144896) Mouse Tagged ORF Clone
MR208833 10 µg

Gatb (NM_144896) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FAM114A1 AAV Vector (Mouse) (CMV)
19720104 1 µg

FAM114A1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
THC-mAb2
A19-Ab2 1 g

THC-mAb2

Sign In for Pricing
View Details