Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP410 Peptide - C-terminal region

CFAP410 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RDMS, SMDAX, LRRC76, YF5/A2, C21orf2

UniProt

O43822

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP410 Rabbit Polyclonal Antibody (orb579585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004919

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKZF2 Antibody
OC-042-01 50 μL

IKZF2 Antibody

Sign In for Pricing
View Details
IKZF2 Antibody
OC-042-02 100 µL

IKZF2 Antibody

Sign In for Pricing
View Details
IKZF2 Antibody
OC-042-03 1 mL

IKZF2 Antibody

Sign In for Pricing
View Details
(S)-3,5-Dihydroxylphenylglycine
TRC-D454520-5MG 5 mg

(S)-3,5-Dihydroxylphenylglycine

Sign In for Pricing
View Details
DDX28 (C-term) Rabbit Polyclonal Antibody
AP51220PU-N 400 µL

DDX28 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAGLN2 Mouse Monoclonal Antibody [Clone ID: OTI7A5]
CF812766 100 µg

TAGLN2 Mouse Monoclonal Antibody [Clone ID: OTI7A5]

Sign In for Pricing
View Details