CFAP410 Peptide - C-terminal region
CFAP410 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RDMS, SMDAX, LRRC76, YF5/A2, C21orf2
UniProt
O43822
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFAP410 Rabbit Polyclonal Antibody (orb579585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004919
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043635-500 1x 500 µL
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSR030240 100 µg
Recombinant Rat Contactin 3/CNTN3 Protein (Fc Tag)
Sign In for Pricing
View Details 
LC431859 20 µg
PAF Receptor (PTAFR) (NM_001164722) Human Over-expression Lysate
Sign In for Pricing
View Details