Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM23 Peptide - N-terminal region

ADAM23 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MDC3

UniProt

O75077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAM23 Rabbit Polyclonal Antibody (orb330481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003803

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD2 Antibody (LFA2/8845R) [mFluor Violet 450 SE]
NBP3-24080MFV450 0.1 mL

Rabbit Monoclonal CD2 Antibody (LFA2/8845R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TRIM39 Antibody
47225 100 µL

TRIM39 Antibody

Sign In for Pricing
View Details
OR11H2 Adenovirus (Human)
34930051 1.0 mL

OR11H2 Adenovirus (Human)

Sign In for Pricing
View Details
Anti-STAT6 Antibody Picoband® (Dylight594 Conjugate)
PB9405-Dylight594 100 µg

Anti-STAT6 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
GP-39 (E-11) PE
sc-376910 PE 200 µg/mL

GP-39 (E-11) PE

Sign In for Pricing
View Details
Human NCKX2 (SLC24A2) (NM_020344) AAV Particle
RC210194A1V 250 µL

Human NCKX2 (SLC24A2) (NM_020344) AAV Particle

Sign In for Pricing
View Details