Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM23 Peptide - N-terminal region

ADAM23 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MDC3

UniProt

O75077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAM23 Rabbit Polyclonal Antibody (orb330481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003803

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Density Regulated Protein (DENR) Antibody
abx003136-01 100 µL

Density Regulated Protein (DENR) Antibody

Sign In for Pricing
View Details
Density Regulated Protein (DENR) Antibody
abx003136-02 200 µL

Density Regulated Protein (DENR) Antibody

Sign In for Pricing
View Details
anti-DARS2
YF-PA19587 100 ug

anti-DARS2

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0042 nucleotide-binding protein SPJ_1472 (SPJ_1472)
MBS1104416-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae UPF0042 nucleotide-binding protein SPJ_1472 (SPJ_1472)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0042 nucleotide-binding protein SPJ_1472 (SPJ_1472)
MBS1104416-02 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae UPF0042 nucleotide-binding protein SPJ_1472 (SPJ_1472)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0042 nucleotide-binding protein SPJ_1472 (SPJ_1472)
MBS1104416-03 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae UPF0042 nucleotide-binding protein SPJ_1472 (SPJ_1472)

Sign In for Pricing
View Details