ECM1 Peptide - middle region
ECM1 Peptide - middle region
Product Specifications
UniProt
Q16610
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ECM1 Rabbit Polyclonal Antibody (orb579791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073155
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P2488-12P-ML405 100 µL
PAK2, CT (p21 Activated Kinase 2, p21-activated Kinase 2, p21 (CDKN1A) -activated Kinase 2, PAK-2, CB422, Gamma PAK, hPAK65, p65-PAK, PAK65, PAKgamma, S6/H4 Kinase, Serine/threonine Protein Kinase PAK 2) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
