Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1 Peptide - middle region

ECM1 Peptide - middle region

Product Specifications

UniProt

Q16610

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ECM1 Rabbit Polyclonal Antibody (orb579791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073155

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TBR2/Eomes Picoband antibody
MBS1750533-01 0.01 mg

Anti-TBR2/Eomes Picoband antibody

Sign In for Pricing
View Details
Anti-TBR2/Eomes Picoband antibody
MBS1750533-02 0.1 mg (Carrier Free)

Anti-TBR2/Eomes Picoband antibody

Sign In for Pricing
View Details
Anti-TBR2/Eomes Picoband antibody
MBS1750533-03 0.1 mg

Anti-TBR2/Eomes Picoband antibody

Sign In for Pricing
View Details
Anti-TBR2/Eomes Picoband antibody
MBS1750533-04 0.1 mg (Cy3)

Anti-TBR2/Eomes Picoband antibody

Sign In for Pricing
View Details
Anti-TBR2/Eomes Picoband antibody
MBS1750533-05 0.1 mg (Biotin)

Anti-TBR2/Eomes Picoband antibody

Sign In for Pricing
View Details
Anti-TBR2/Eomes Picoband antibody
MBS1750533-06 0.1 mg (HRP)

Anti-TBR2/Eomes Picoband antibody

Sign In for Pricing
View Details