CRTAP Peptide - C-terminal region
CRTAP Peptide - C-terminal region
Product Specifications
UniProt
C9JP16
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CRTAP Rabbit Polyclonal Antibody (orb330490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ZFP200 (ZNF200) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F10]](https://cdn.genprice.uk/products/937/6868c3d8994c49e6dc400a05/imageurl/ta808214bm.webp)
TA808214BM 100 µL
ZFP200 (ZNF200) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F10]
Sign In for Pricing
View Details 
BNC683101-100 1x 100 µL
PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882579-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880011-100 1x 100 µL
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![IL6 Mouse Monoclonal Antibody [Clone ID: 1E3]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fcbd0/imageurl/am26387pu-l.webp)
