CRTAP Peptide - C-terminal region
CRTAP Peptide - C-terminal region
Product Specifications
UniProt
C9JP16
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CRTAP Rabbit Polyclonal Antibody (orb330490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472387-100 1x 100 µL
SOX9 / SRY-box 9 (SOX9/2387), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![SnoN (SKIL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F6]](https://cdn.genprice.uk/products/937/68dd1b75061270361ea19e45/imageurl/ta800160bm.webp)
TA800160BM 100 µL
SnoN (SKIL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F6]
Sign In for Pricing
View Details 
