C16orf78 Peptide - N-terminal region
C16orf78 Peptide - N-terminal region
Product Specifications
UniProt
Q8WTQ4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C16orf78 Rabbit Polyclonal Antibody (orb325772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_653203
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GKGLMTARGGNRRDTETSQQALGKRFRKDAASYRSLYGVEQKGKHLSMVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401037-500 1x 500 µL
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942958-100 1x 100 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880639-100 1x 100 µL
CD31 / PECAM-1 (JC/70A), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details