Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK8 Peptide - C-terminal region

AK8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf98, DDX31, RP11-143F18.1

UniProt

Q96MA6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AK8 Rabbit Polyclonal Antibody (orb325816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689785

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Protein phosphatase 1E (PPM1E) ELISA Kit
MBS9931318 Inquire

Rabbit Protein phosphatase 1E (PPM1E) ELISA Kit

Sign In for Pricing
View Details
Dusigitumab Biosimilar - Research Grade
ICH5494-1mg 1 mg

Dusigitumab Biosimilar - Research Grade

Sign In for Pricing
View Details
HAS1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-2946R-BF555-TR 20 µL

HAS1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal RNPEPL1 Antibody (4A9)
NBP2-59371 100 µg

Mouse Monoclonal RNPEPL1 Antibody (4A9)

Sign In for Pricing
View Details
NK-3R CRISPR/Cas9 KO Plasmid (m)
sc-423254 20 µg

NK-3R CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Human Activin RIB/ALK-4 (NP_004293) VersaClone cDNA
RDC1202 10 µg

Human Activin RIB/ALK-4 (NP_004293) VersaClone cDNA

Sign In for Pricing
View Details