Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK8 Peptide - C-terminal region

AK8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf98, DDX31, RP11-143F18.1

UniProt

Q96MA6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AK8 Rabbit Polyclonal Antibody (orb325816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689785

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAN Recombinant Protein
OPCD01175-200UG 200 µg

ACAN Recombinant Protein

Sign In for Pricing
View Details
FREM2 Double Nickase Plasmid (h2)
sc-408000-NIC-2 20 µg

FREM2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
OR10V7P sgRNA CRISPR Lentivector (Human) (Target 3)
K1555504 1.0 µg DNA

OR10V7P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SUMO3 (Small Ubiquitin-Related Modifier 3, SUMO-3, Ubiquitin-Like Protein SMT3A, SMT3 Homolog 1, SUMO-2, SMT3A, SMT3H1) (MaxLight 405) discontinued
S8026-20A-ML405 100 µL

SUMO3 (Small Ubiquitin-Related Modifier 3, SUMO-3, Ubiquitin-Like Protein SMT3A, SMT3 Homolog 1, SUMO-2, SMT3A, SMT3H1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
EphB2 Polyclonal Antibody
UB-GEN-13026 100 µL

EphB2 Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal C3orf22 antibody - middle region
APR01173G 0.05mg

Polyclonal C3orf22 antibody - middle region

Sign In for Pricing
View Details