Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROSER2 Peptide - C-terminal region

PROSER2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf47

UniProt

D3DRR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROSER2 Rabbit Polyclonal Antibody (orb55698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRG

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO2/3 discontinued
514727 100 µg

SUMO2/3 discontinued

Sign In for Pricing
View Details
Human NUMBL / Numb-Like Protein Recombinant Protein
MBS2903364 Inquire

Human NUMBL / Numb-Like Protein Recombinant Protein

Sign In for Pricing
View Details
GFPT2-set siRNA/shRNA/RNAi Lentivector (Human)
21459091 4x 500 ng

GFPT2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
SH2D5 (m) -PR
sc-153431-PR 10 µM - 20 µL

SH2D5 (m) -PR

Sign In for Pricing
View Details
GM2 Ganglioside Activator (GM2A) Antibody
abx172658 1 mL

GM2 Ganglioside Activator (GM2A) Antibody

Sign In for Pricing
View Details
TORC2 Rabbit Polyclonal Antibody (APC)
orb1006866 100 µL

TORC2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details